DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PBD1

DIOPT Version :10

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_188902.1 Gene:PBD1 / 821834 AraportID:AT3G22630 Length:204 Species:Arabidopsis thaliana


Alignment Length:203 Identity:43/203 - (21%)
Similarity:77/203 - (37%) Gaps:62/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GVRGANCVVLGVEKSSVSEM-----QEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQS 95
            |:.|....::..:.|:|..:     .||    ||.:||.|..:|.:|...|              
plant     6 GLVGNGFAIVAADTSAVHSILLHKNNED----KIMVLDSHKLVAASGEPGD-------------- 52

  Fly    96 HRLNFENQVTLEYITRYLAQLKQKYTQCNG---------------------RRPFGISCLIGGID 139
             |:.|     .||:.:.::..|.:    ||                     :.|:.::.|:.|.|
plant    53 -RVQF-----TEYVQKNVSLYKFR----NGIPLTTAAAANFTRGELATALRKNPYSVNILMAGYD 107

  Fly   140 ADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAY-SDHEVTTKCDAIKLAMRALLEVTQM 203
            .:..|.|::.:.....|:....|.|..:.......::.| ||..|.   :||:|..:.:||:   
plant   108 DESGASLYYIDYIATLHKVDKGAFGYGSYFSLSTMDRHYRSDMSVE---EAIELVDKCILEI--- 166

  Fly   204 SQMRLEVA 211
             :.||.||
plant   167 -RSRLVVA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 proteasome_alpha_type_7 5..213 CDD:239724 43/203 (21%)
PBD1NP_188902.1 proteasome_beta_type_2 1..192 CDD:239727 43/203 (21%)

Return to query results.
Submit another query.