DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PAG1

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001323455.1 Gene:PAG1 / 817244 AraportID:AT2G27020 Length:351 Species:Arabidopsis thaliana


Alignment Length:231 Identity:70/231 - (30%)
Similarity:112/231 - (48%) Gaps:20/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISMLDR 69
            |..::|.|||||.:.|:|||.:||....|.||::..:.:|:||||...|:|....:.|:|..:.|
plant   110 YDLSVTTFSPDGRVFQIEYAAKAVDNSGTVVGIKCKDGIVMGVEKLIASKMMLPGSNRRIHSVHR 174

  Fly    70 HVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCL 134
            |..:|.|||.||.|.::.|.:.|.:|:...:.:.|.::.::..:|......|.....||||...:
plant   175 HAGMAVAGLAADGRQIVARAKSEARSYESVYGDAVPVKELSERVASYVHLCTLYWWLRPFGCGVI 239

  Fly   135 IGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEK------------------AYSDH 181
            :||.|.|| .:|:..|||||.:.|...|.|:.....:...||                  .|..|
plant   240 LGGYDRDG-PQLYMIEPSGISYRYFGAAIGKGKQAAKTEIEKLNLSEMTCKEGVIEVAKIIYKLH 303

  Fly   182 EVTTKCDAIKLAMRALLEVTQMSQMRLEVAVLENGK 217
            : ..|..|.:|.|..:.|.::....::...:||..|
plant   304 D-EAKDKAFELEMSWICEESKREHQKVPDDLLEEAK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 70/231 (30%)
proteasome_alpha_type_7 5..213 CDD:239724 67/225 (30%)
PAG1NP_001323455.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.