DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psma8

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001157081.1 Gene:Psma8 / 73677 MGIID:1920927 Length:250 Species:Mus musculus


Alignment Length:249 Identity:147/249 - (59%)
Similarity:191/249 - (76%) Gaps:1/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKIS 65
            |:|||.||:|:|||||||.|||||||||:|||||||:||.|.|||||||.||:::|::||||||.
Mouse     1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKIC 65

  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130
            .||.||.:||||||||||::|:|.:||||||:|..|:.||:|||||::|.|||||||.|||||||
Mouse    66 ALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFG 130

  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMR 195
            ||.||.|.|.||..||:.|:|||.:|.:||.|.||.|.|||||.||.|::..::...:|||||::
Mouse   131 ISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDKEAIKLAIK 195

  Fly   196 ALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAKAHKMKR 249
            |||||.|.....:|:|::...:|:||..:..|...|..::.||: :|:..|.|:
Mouse   196 ALLEVVQSGGKNIELAIIRRDQPLKMFSAKEIELEVSEIEREKD-EAEKTKSKK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 140/233 (60%)
proteasome_alpha_type_7 5..213 CDD:239724 134/207 (65%)
Psma8NP_001157081.1 PRK03996 5..235 CDD:235192 139/229 (61%)
proteasome_alpha_type_7 5..213 CDD:239724 134/207 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 272 1.000 Domainoid score I1792
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2086
Inparanoid 1 1.050 343 1.000 Inparanoid score I2316
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - mtm8808
orthoMCL 1 0.900 - - OOG6_101207
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.