Sequence 1: | NP_650910.1 | Gene: | Prosalpha4T1 / 42457 | FlyBaseID: | FBgn0265606 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021324576.1 | Gene: | psmb7 / 64278 | ZFINID: | ZDB-GENE-001208-4 | Length: | 286 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 45/206 - (21%) |
---|---|---|---|
Similarity: | 81/206 - (39%) | Gaps: | 9/206 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 DGHLLQVEYAQEAVRK-GSTAVGVRGANCVVLGVEKSSVSEM-QEDRTVRKISMLDRHVALAFAG 77
Fly 78 LTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADG 142
Fly 143 SARLFHTEPSGIFHEYKATATGRWANTVREFFEKAY-SDHEVTTKCDAIKLAMRALLEVTQMSQM 206
Fly 207 RLEVAVLENGK 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha4T1 | NP_650910.1 | PRK03996 | 5..239 | CDD:235192 | 45/206 (22%) |
proteasome_alpha_type_7 | 5..213 | CDD:239724 | 42/200 (21%) | ||
psmb7 | XP_021324576.1 | proteasome_beta_type_7 | 44..232 | CDD:239732 | 41/188 (22%) |
Pr_beta_C | 237..280 | CDD:315191 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |