DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psmb7

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_021324576.1 Gene:psmb7 / 64278 ZFINID:ZDB-GENE-001208-4 Length:286 Species:Danio rerio


Alignment Length:206 Identity:45/206 - (21%)
Similarity:81/206 - (39%) Gaps:9/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DGHLLQVEYAQEAVRK-GSTAVGVRGANCVVLGVEKSSVSEM-QEDRTVRKISMLDRHVALAFAG 77
            :..:.::.::..|.|| |:|..|:...:.||||.:..:...| ..|:...||..:..::....||
Zfish    26 EADITKLGFSSPAARKTGTTICGIVYKDGVVLGADTRATEGMIVADKNCSKIHYISPNIYCCGAG 90

  Fly    78 LTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADG 142
            ..||..:.........:.|.|:......:....|.|.|:..:|     :...|.:.::||:|..|
Zfish    91 TAADTEMTTQIISSNLELHSLSTGRLPRVATANRMLKQMLFRY-----QGYIGAALVLGGVDCTG 150

  Fly   143 SARLFHTEPSGIFHEYKATATGRWANTVREFFEKAY-SDHEVTTKCDAIKLAMRALLEVTQMSQM 206
             ..|:...|.|...:......|..:......||..| .|.|.......::.|:.|.:.....|..
Zfish   151 -PHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDRYRPDMEEEDAKSLVRDAIAAGIFNDLGSGS 214

  Fly   207 RLEVAVLENGK 217
            .::|.|:..||
Zfish   215 NIDVCVITKGK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 45/206 (22%)
proteasome_alpha_type_7 5..213 CDD:239724 42/200 (21%)
psmb7XP_021324576.1 proteasome_beta_type_7 44..232 CDD:239732 41/188 (22%)
Pr_beta_C 237..280 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.