Sequence 1: | NP_650910.1 | Gene: | Prosalpha4T1 / 42457 | FlyBaseID: | FBgn0265606 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_683720.2 | Gene: | PSMB8 / 5696 | HGNCID: | 9545 | Length: | 276 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 41/203 - (20%) |
---|---|---|---|
Similarity: | 76/203 - (37%) | Gaps: | 51/203 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADA 82
Fly 83 ----RILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS--CLIGGIDAD 141
Fly 142 G-------------SARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLA 193
Fly 194 MRALLEVT 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha4T1 | NP_650910.1 | PRK03996 | 5..239 | CDD:235192 | 41/203 (20%) |
proteasome_alpha_type_7 | 5..213 | CDD:239724 | 41/203 (20%) | ||
PSMB8 | NP_683720.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | ||
proteasome_beta_type_5 | 73..260 | CDD:239730 | 37/190 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |