DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PSMA2

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_002778.1 Gene:PSMA2 / 5683 HGNCID:9531 Length:234 Species:Homo sapiens


Alignment Length:216 Identity:80/216 - (37%)
Similarity:128/216 - (59%) Gaps:8/216 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSR-YGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKI 64
            |:.| |..:||.|||.|.|:|:|||..||..|:.:||::.||.|||..||...|.:.::|:|.|:
Human     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKV 65

  Fly    65 SMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPF 129
            ..:.:|:.|.::|:..|.|:|::|.:...|.:.|.::..:....:.:.:|.:.|:|||..|.|||
Human    66 EPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPF 130

  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYS-DHEVTTKCDAIKLA 193
            |:|.||.|.: :|...||.::|||.:..:||||.|:.....:.|.||.|: |.|:.   |||..|
Human   131 GVSLLICGWN-EGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELE---DAIHTA 191

  Fly   194 MRALLE--VTQMSQMRLEVAV 212
            :..|.|  ..||::..:||.:
Human   192 ILTLKESFEGQMTEDNIEVGI 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 78/211 (37%)
proteasome_alpha_type_7 5..213 CDD:239724 78/211 (37%)
PSMA2NP_002778.1 proteasome_alpha_type_2 6..231 CDD:239719 78/211 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.