DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psma3

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001011257.1 Gene:psma3 / 496707 XenbaseID:XB-GENE-976787 Length:255 Species:Xenopus tropicalis


Alignment Length:246 Identity:84/246 - (34%)
Similarity:131/246 - (53%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISMLDR 69
            |..:.:.|||||.:.|||||.:||...|||:|:|..:.||.||||..:|::.|:.:.::|..:||
 Frog     8 YDLSASTFSPDGRVFQVEYAAKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRIFNVDR 72

  Fly    70 HVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCL 134
            ||.:|.|||.||||.|.:..:.|..:.|.|:...:.|::::..:|.....||..:..||||.|.:
 Frog    73 HVGMAVAGLLADARSLADIAREEASNFRANYGYDIPLKHLSDRVAMYVHAYTLYSAVRPFGCSFM 137

  Fly   135 IGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALL- 198
            :|..:.|..|:|:..:||||.:.|...|.|:.....:...||... .::|.: |.:|...:.:. 
 Frog   138 LGSYNEDDGAQLYMVDPSGISYGYWGCAIGKAKQAAKTEIEKLQM-KDMTCR-DVVKEVAKIIYI 200

  Fly   199 ---EVTQMS-QMRLE-VAVLENGKPMKMLDSVVISEIV-KIVQNEKELQAK 243
               ||...| ::.|. |..:.|||          .||| |.::.|.|..||
 Frog   201 VHDEVKDKSFELELSWVGKITNGK----------HEIVPKDIREEAEKYAK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 81/240 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 73/213 (34%)
psma3NP_001011257.1 proteasome_alpha_type_3 5..217 CDD:239720 72/210 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.