DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psma1

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001003427.1 Gene:psma1 / 445033 ZFINID:ZDB-GENE-040801-15 Length:262 Species:Danio rerio


Alignment Length:225 Identity:71/225 - (31%)
Similarity:119/225 - (52%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            ::|...:|::||.|.:.|:|||.|||::||..||::..:..||...|.:.||:...:  :||..:
Zfish     4 NQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSHSHAVLVALKRAQSELAAHQ--KKILHV 66

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
            |.|:.::.||||||||:|.|..:.||...|..|:..:.:..:...:....|..||..||||:|:.
Zfish    67 DNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVG 131

  Fly   133 CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEK---AYSDHEVTTKCDAIKLAM 194
            .||.|.| |....:|.|.||..:.:.||.:.|..:.:.|.:.|:   |::|..:..   .::..:
Zfish   132 LLIAGYD-DMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMEAFNDCNLNA---LVQHGL 192

  Fly   195 RALLEVTQMSQ----MRLEVAVLENGKPMK 220
            |||.|.....|    ..:.:.::  ||.|:
Zfish   193 RALRETLPAEQDLTTKNVSIGIV--GKDME 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 71/223 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 68/214 (32%)
psma1NP_001003427.1 PRK03996 1..238 CDD:235192 71/225 (32%)
proteasome_alpha_type_1 6..216 CDD:239718 68/217 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.