DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psmb2

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001002609.1 Gene:psmb2 / 436882 ZFINID:ZDB-GENE-040718-353 Length:199 Species:Danio rerio


Alignment Length:219 Identity:38/219 - (17%)
Similarity:79/219 - (36%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGVRGANCVVL---GVEKSSVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQSH 96
            :|::|.:.|::   .|..||:.:|:.|  ..|:..|...:.|...|...|........|...|.:
Zfish     5 IGIQGPDFVLVAADNVAASSIIQMKHD--YDKMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQLY 67

  Fly    97 RL------------NFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADGSARLFHT 149
            ::            ||..:...:|:              ..|.|:.::.|:.|.|......|::.
Zfish    68 KMRNGYELSPAAAANFTRKNLADYL--------------RSRTPYHVNLLLAGYDETDGPGLYYM 118

  Fly   150 EPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALLEVTQMSQMRLEVAVLE 214
            :......:....|.|..|.......::.|...  .|:.:|:.|..:.|.|:.:...:.|.     
Zfish   119 DYLSALAKAPFAAHGYGAFLTLSILDRYYRPD--LTREEAVDLLKKCLEELNKRFILNLP----- 176

  Fly   215 NGKPMKMLDSVVISEIVKIVQNEK 238
             ...::::|...|.::.|:....|
Zfish   177 -SFTVRLIDKDGIHDMEKLPVGRK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 38/219 (17%)
proteasome_alpha_type_7 5..213 CDD:239724 34/192 (18%)
psmb2NP_001002609.1 proteasome_beta_type_2 1..192 CDD:239727 36/210 (17%)
PRE1 5..188 CDD:223711 35/206 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.