DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Prosalpha2

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster


Alignment Length:232 Identity:79/232 - (34%)
Similarity:131/232 - (56%) Gaps:10/232 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISM 66
            :.||..:||.|||.|.|:|:|||..||..|:.:||:..:|.||:..|....|.:.|..:|.::.|
  Fly     3 TERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEM 67

  Fly    67 LDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGI 131
            :..|:.:.::|:..|.|:|:.:.:...|::.|.::..:.:..:.:.:|.|.|:|||..|.||||:
  Fly    68 IYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGV 132

  Fly   132 SCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYS-DHEVTTKCDAIKLAMR 195
            |.||.|.|.| ...|:.::|||.:..:||||.|:.|...:.|.||.|| |.|:.   ||:..|:.
  Fly   133 SLLICGWDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELD---DAVHTAIL 193

  Fly   196 ALLE--VTQMSQMRLEVAVL-ENGKPMKMLDSVVISE 229
            .|.|  ..:|:...:|:.:. :||  .:.||...|.:
  Fly   194 TLKEGFEGKMTADNIEIGICDQNG--FQRLDPASIKD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 78/229 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 73/210 (35%)
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 78/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.