DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psma8

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_998331.1 Gene:psma8 / 406445 ZFINID:ZDB-GENE-040426-2194 Length:251 Species:Danio rerio


Alignment Length:249 Identity:154/249 - (61%)
Similarity:195/249 - (78%) Gaps:0/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKIS 65
            |::||.||:|:|||||||.|||||||||:|||||||:||.:.|||||||.||:::||:||||||.
Zfish     1 MAARYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGKDIVVLGVEKKSVAKLQEERTVRKIC 65

  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130
            .||.||.:|||||||||||:|||.:||||||||..|:.||:||||||:|.|||:|||.|||||||
Zfish    66 ALDEHVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNGRRPFG 130

  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMR 195
            ||.||.|.|.||:.||:.|:|||.:|.:||.|.||.|.|||||.||.|:|..:.:..||||||::
Zfish   131 ISALIVGFDYDGTPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTDEAIASDNDAIKLAIK 195

  Fly   196 ALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAKAHKMKR 249
            |||||.|.....:|:||:...:|:|:|:|..|..:|..::.|||.:|:..|.|:
Zfish   196 ALLEVVQSGGKNIELAVIRRNQPLKILESKEIETLVAEIEKEKEEEAEKKKQKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 147/233 (63%)
proteasome_alpha_type_7 5..213 CDD:239724 139/207 (67%)
psma8NP_998331.1 proteasome_alpha_type_7 5..213 CDD:239724 139/207 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 273 1.000 Domainoid score I1754
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2086
Inparanoid 1 1.050 358 1.000 Inparanoid score I2180
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - otm26530
orthoMCL 1 0.900 - - OOG6_101207
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.