DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Prosbeta2R2

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster


Alignment Length:187 Identity:45/187 - (24%)
Similarity:71/187 - (37%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTAVGVRGANCVVLGVEKSSVS-EMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQ 94
            |:|.||:.....|::|.|..:.| .:...:|.|||..|..::..|.||...|.:.|:...:.:.:
  Fly    49 GTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLE 113

  Fly    95 SHRLN---------FENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADGSARLFHTE 150
            .||:|         ..||:..:.:.|:           ||.  .....:|||.|..| |.||.|.
  Fly   114 LHRMNTGFRKVPVCCANQMIRQLLFRF-----------NGN--IDADMIIGGADNTG-AHLFCTR 164

  Fly   151 PSGIFHEYKATATG------------RWANTVREFFEKAYSDHEVTTKCDAIKLAMR 195
            ..|.......|:.|            ||:..:.|       :......|||:...|:
  Fly   165 SDGSTDTAPFTSIGSGYQVSMSILESRWSEDLSE-------ESACALACDAVAAGMK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 45/187 (24%)
proteasome_alpha_type_7 5..213 CDD:239724 45/187 (24%)
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 45/187 (24%)
proteasome_beta_type_7 50..239 CDD:239732 44/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441107
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.