DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:151 Identity:31/151 - (20%)
Similarity:64/151 - (42%) Gaps:7/151 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVE 92
            :.|:|.||:...:.|:||.: :::...:..|:...||..|.:::....||..||..:..:....:
  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQ 101

  Fly    93 CQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADGSARLFHTEPSGIFHE 157
            .:.|||..:.:|.:......|.|:..:|     :.....:.::||:|..| ..::...|.|...:
  Fly   102 LELHRLQTDREVRVVAANTMLKQMLFRY-----QGHISAALVLGGVDKTG-PHIYSIHPHGSSDK 160

  Fly   158 YKATATGRWANTVREFFEKAY 178
            ......|..:......||..:
  Fly   161 LPYATMGSGSLAAMTVFESRW 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 31/151 (21%)
proteasome_alpha_type_7 5..213 CDD:239724 31/151 (21%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 29/146 (20%)
proteasome_beta_type_7 42..228 CDD:239732 29/146 (20%)
Pr_beta_C 232..264 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.