DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Prosalpha4

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster


Alignment Length:249 Identity:187/249 - (75%)
Similarity:213/249 - (85%) Gaps:0/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKIS 65
            |||||.||:||||||||||||||||||||||||||||||||||||||||.||:::||||.||||.
  Fly     1 MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKIC 65

  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130
            |||.||.:|||||||||||:|||.||||||||||.|:.||||||||::|||||||||.|||||||
  Fly    66 MLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFG 130

  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMR 195
            |||||||.||||||.||.|||||||:||||.||||.|..|||||||:|.:.||..:..|:|||:|
  Fly   131 ISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIR 195

  Fly   196 ALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAKAHKMKR 249
            |||||.|..|..||||::|||||:||||:.||::.|||::.|||.:.:..|.|:
  Fly   196 ALLEVAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 179/233 (77%)
proteasome_alpha_type_7 5..213 CDD:239724 164/207 (79%)
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 175/225 (78%)
proteasome_alpha_type_7 5..213 CDD:239724 164/207 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462326
Domainoid 1 1.000 220 1.000 Domainoid score I721
eggNOG 1 0.900 - - E1_COG0638
Homologene 1 1.000 - - H2086
Inparanoid 1 1.050 270 1.000 Inparanoid score I920
Isobase 1 0.950 - 0 Normalized mean entropy S208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - otm26530
orthoMCL 1 0.900 - - OOG6_101207
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1345
1312.750

Return to query results.
Submit another query.