DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psmb2

DIOPT Version :10

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_058980.1 Gene:Psmb2 / 29675 RGDID:61874 Length:201 Species:Rattus norvegicus


Alignment Length:181 Identity:36/181 - (19%)
Similarity:71/181 - (39%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGVRGANCVVLG---VEKSSVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQSH 96
            :|::|.:.|::.   |..|::.:|::|..  |:..:...:.|...|...|........|...|.:
  Rat     5 IGIQGPDYVLVASDRVAASNIVQMKDDHD--KMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLY 67

  Fly    97 RL--NFENQVT--LEYITRYLAQLKQKYTQC-NGRRPFGISCLIGGIDADGSARLFHTEPSGIFH 156
            ::  .:|...|  ..:..|.||       .| ..|.|:.::.|:.|.|.       |..|:..:.
  Rat    68 KMRNGYELSPTAAANFTRRNLA-------DCLRSRTPYHVNLLLAGYDE-------HEGPALYYM 118

  Fly   157 EYKA-------TATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALLEV 200
            :|.|       .|.|..|.......::.|:  ...::..|::|..:.|.|:
  Rat   119 DYLAALAKAPFAAHGYGAFLTLSILDRYYT--PTISRERAVELLRKCLEEL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 proteasome_alpha_type_7 5..213 CDD:239724 36/181 (20%)
Psmb2NP_058980.1 proteasome_beta_type_2 1..192 CDD:239727 36/181 (20%)

Return to query results.
Submit another query.