DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psma3

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_058976.1 Gene:Psma3 / 29670 RGDID:61844 Length:255 Species:Rattus norvegicus


Alignment Length:244 Identity:74/244 - (30%)
Similarity:123/244 - (50%) Gaps:38/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISMLDR 69
            |..:.:.|||||.:.|||||.:||...|||:|:|..:.||.||||..:|::.|:.:.:::..:||
  Rat     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDR 72

  Fly    70 HVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCL 134
            ||.:|.|||.||||.|.:..:.|..:.|.||...:.|:::...:|.....||..:..||||.|.:
  Rat    73 HVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFM 137

  Fly   135 IGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALLE 199
            :|....:..|:|:..:|||:.:.|...|.|:                        .:.|.:..:|
  Rat   138 LGSYSVNDGAQLYMIDPSGVSYGYWGCAIGK------------------------ARQAAKTEIE 178

  Fly   200 VTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAKAHKMK 248
            ..||.:|.....|.|            :::|:.||.:  |::.||.:::
  Rat   179 KLQMKEMTCRDVVKE------------VAKIIYIVHD--EVKDKAFELE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 71/233 (30%)
proteasome_alpha_type_7 5..213 CDD:239724 66/207 (32%)
Psma3NP_058976.1 proteasome_alpha_type_3 5..217 CDD:239720 74/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.