DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psma4

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_036096.1 Gene:Psma4 / 26441 MGIID:1347060 Length:261 Species:Mus musculus


Alignment Length:256 Identity:83/256 - (32%)
Similarity:147/256 - (57%) Gaps:11/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTV-RKI 64
            ||.||....|||||:|.|.|||||.||:....|.:|:...:.|:|..|:.::.::.::... .||
Mouse     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKI 65

  Fly    65 SMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPF 129
            ..|:..:|.:.||:|:||.:|.|..::..|.:.|.::..:..|.:...|..:||.|||..|:|||
Mouse    66 YKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPF 130

  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAM 194
            |:|.|..|.|.....:|:.::|||.:..:|||..|..:.......::.|.:.|:|.| .|:.||:
Mouse   131 GVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLK-SALALAV 194

  Fly   195 RAL---LEVTQMSQMRLEVAVL--ENGKP-MKMLDSVVISEIVKIVQNEKELQAKAHKMKR 249
            :.|   ::|:::|..::|:|.|  |:||. :::|..   .|:.::::..:|.:|||.:.|:
Mouse   195 KVLNKTMDVSKLSAEKVEIATLTRESGKTVIRVLKQ---KEVEQLIKKHEEEEAKAEREKK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 75/240 (31%)
proteasome_alpha_type_7 5..213 CDD:239724 69/211 (33%)
Psma4NP_036096.1 proteasome_alpha_type_4 3..216 CDD:239721 70/213 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.