DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and pup2

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_594372.1 Gene:pup2 / 2543205 PomBaseID:SPAC323.02c Length:247 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:86/261 - (32%)
Similarity:138/261 - (52%) Gaps:35/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            |.|.|.:..|||:|.|.|||||.||::.||||:||:..:.|||||||...|.:.|..:|.|:..:
pombe     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKDAVVLGVEKRLTSPLMESHSVEKLFEI 70

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNG------R 126
            |.|:..|.:|||||||.:|...:|:.|:||..::....:|..|:.:..|..::.:...      .
pombe    71 DSHIGCAISGLTADARTIIEHARVQTQNHRFTYDEPQGIESTTQSICDLALRFGEGEDGEERIMS 135

  Fly   127 RPFGISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIK 191
            ||||::.||.|||..| .:|:|:||||.:..|:|.|.|..:...:....|.:  |:..|..:|..
pombe   136 RPFGVALLIAGIDEHG-PQLYHSEPSGTYFRYEAKAIGSGSEPAKSELVKEF--HKDMTLEEAEV 197

  Fly   192 LAMRALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKI-------VQNEKEL-QAKAHKMK 248
            |.::.|.:|.:                 :.|||..: ::.|:       :.|::|: .|.|.:.:
pombe   198 LILKVLRQVME-----------------EKLDSKNV-QLAKVTAEGGFHIYNDEEMADAVAREQQ 244

  Fly   249 R 249
            |
pombe   245 R 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 81/246 (33%)
proteasome_alpha_type_7 5..213 CDD:239724 76/213 (36%)
pup2NP_594372.1 PRK03996 8..241 CDD:235192 83/253 (33%)
proteasome_alpha_type_5 8..221 CDD:239722 79/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.