DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psmb8

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_542945.2 Gene:Psmb8 / 24968 RGDID:3426 Length:276 Species:Rattus norvegicus


Alignment Length:190 Identity:38/190 - (20%)
Similarity:81/190 - (42%) Gaps:25/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADA 82
            :|:|.|.     |:|.:..:..:.|::.|: ::|.........|.|:..::.::....:|..||.
  Rat    65 VQIEMAH-----GTTTLAFKFQHGVIVAVDSRASAGSYIATIRVNKVIEINPYLLGTMSGCAADC 124

  Fly    83 ----RILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS--CLIGGIDAD 141
                |:|..    ||:.:.|....::::...::.|:.:..:|      |..|:|  .:|.|.|..
  Rat   125 QYWERLLAK----ECRLYYLRNGERISVSAASKLLSNMMLQY------RGMGLSMGSMICGWDKK 179

  Fly   142 GSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALLEVT 201
            |.. |::.:.:|.....:..:||..........:..|  .:..:..:|..||.||::..|
  Rat   180 GPG-LYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGY--RQDLSPEEAYDLARRAIVYAT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 38/190 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 38/190 (20%)
Psmb8NP_542945.2 PTZ00488 40..271 CDD:185666 38/190 (20%)
proteasome_beta_type_5 73..260 CDD:239730 34/177 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.