DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and pbs-5

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_493558.1 Gene:pbs-5 / 173334 WormBaseID:WBGene00003951 Length:284 Species:Caenorhabditis elegans


Alignment Length:200 Identity:41/200 - (20%)
Similarity:79/200 - (39%) Gaps:28/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQVEYAQEA-----VRKGSTAVGV---------RGANCVVLGVE-KSSVSEMQEDRTVRKISMLD 68
            ::..:|:.|     .|||:|.:..         :|.  :::.|: ::|..|....::|.||..:.
 Worm    47 MKTHFAETAGKSMQFRKGTTTLAFVYEPATPADKGG--IIVAVDSRASSGEYISSKSVMKILDIG 109

  Fly    69 RHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS- 132
            ..:....||..||.:.........|..:.|..:..:|:...::|.|.....|      |..|:| 
 Worm   110 DRMVATMAGGAADCQFWTRIVAKYCTLYELREKTSITVSAASKYFANTLYGY------RGQGLSV 168

  Fly   133 -CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRA 196
             .::.|.|..| .::|..:..|...:.|..:.|..:.......:..|...  .|..:|.||.:||
 Worm   169 GSMVAGYDKKG-PQIFKVDSEGDRCQLKVCSVGSGSLNAYGILDNHYKPK--MTDDEARKLGLRA 230

  Fly   197 LLEVT 201
            ::..|
 Worm   231 IMHAT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 40/199 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 40/199 (20%)
pbs-5NP_493558.1 Ntn_hydrolase 65..252 CDD:320988 35/181 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.