DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psma6a

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_705941.2 Gene:psma6a / 171585 ZFINID:ZDB-GENE-020326-1 Length:246 Species:Danio rerio


Alignment Length:246 Identity:62/246 - (25%)
Similarity:126/246 - (51%) Gaps:15/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRYGRALTIFSPDGHLLQVEYAQEAVRKGS-TAVGVRGANCVVLGVEKSSVSEMQEDRTVRKIS 65
            |:.:.|.:|||||:|.|.|||||.:|:.:|. |:|.|||.:|.|:..::....::.:..||..:.
Zfish     6 SAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKLLDSSTVTHLF 70

  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130
            .:..::....:|:|||:|..:.|.:.|..:.:..:..::.::.:.:.:|.:.|.|||....||.|
Zfish    71 RITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLG 135

  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCD-----AI 190
            ...::.|:|.:...:::..:|:|.:..:||||.|........|.||     ::..|.|     .:
Zfish   136 CCMIVVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEK-----KIKKKLDWTFDQTV 195

  Fly   191 KLAMRALLEVTQM----SQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNE 237
            :.|:..|..|..:    |::.:.|...|..|...:.:|.:.:.::.:.:.:
Zfish   196 ETAISCLSTVLAIDFKPSELEIGVVTTEEPKFRILSESEIDTHLMALTERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 61/243 (25%)
proteasome_alpha_type_7 5..213 CDD:239724 58/217 (27%)
psma6aNP_705941.2 PRK03996 6..239 CDD:235192 62/237 (26%)
proteasome_alpha_type_6 8..220 CDD:239723 57/216 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.