DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psmb11b

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001268731.1 Gene:psmb11b / 100331481 ZFINID:ZDB-GENE-170530-2 Length:362 Species:Danio rerio


Alignment Length:137 Identity:33/137 - (24%)
Similarity:52/137 - (37%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVL---GVEKSSVSEMQEDRTVR 62
            |:.||... |:.|...       :|.|...|.:  ||||...|.:   |:............:..
Zfish   225 MTERYANT-TLTSKSS-------SQSAASSGLS--GVRGPRVVYVCSDGLRLQGALFSVGSGSPY 279

  Fly    63 KISMLDRHVALAFAGLTADARILINRGQVECQSHRLNFE-NQVTLEYIT------RYLAQLKQKY 120
            ..|:||..|..   |::|.....:.|..|...::|..:. |.|.|.::|      |....||::|
Zfish   280 AYSILDGGVRW---GMSAQEAAAVAREAVYRATYRDAYSGNNVDLYHVTAKGWRRRERENLKEEY 341

  Fly   121 TQCNGRR 127
            .:...||
Zfish   342 YREKERR 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 31/133 (23%)
proteasome_alpha_type_7 5..213 CDD:239724 31/133 (23%)
psmb11bNP_001268731.1 proteasome_beta_type_5 110..333 CDD:239730 27/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.