DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psma5

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001096282.1 Gene:psma5 / 100124849 XenbaseID:XB-GENE-982653 Length:241 Species:Xenopus tropicalis


Alignment Length:237 Identity:82/237 - (34%)
Similarity:135/237 - (56%) Gaps:10/237 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            |.|.|.:..|||:|.|.|||||.||::.||||:|::.:..|.|.|||...|.:.|..::.||..:
 Frog     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI 70

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNG-----RR 127
            |.|:..|.:||.|||:.||::.:||.|:|...:...:|:|.:|:.::.|..::.:.:.     .|
 Frog    71 DAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSR 135

  Fly   128 PFGISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKL 192
            |||::.|.||.|..| .:|||.:|||.|.:..|.|.|..:...:...::.|  |:..|..:|||.
 Frog   136 PFGVALLFGGADEKG-PQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVY--HKSMTLKEAIKS 197

  Fly   193 AMRALLEVTQ--MSQMRLEVAVLENGKPMKMLDSVVISEIVK 232
            ::..|.:|.:  ::...:|:|.:|.||...|.....:.|::|
 Frog   198 SLTILKQVMEEKLNATNIELATIEPGKKFHMYCKEELEEVIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 81/235 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 75/214 (35%)
psma5NP_001096282.1 proteasome_alpha_type_5 8..220 CDD:239722 75/214 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.