DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31199 and CG42694

DIOPT Version :10

Sequence 1:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:231 Identity:51/231 - (22%)
Similarity:84/231 - (36%) Gaps:62/231 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIRDNG--- 70
            ||::.:....|.| |..||.|||    .:.|...|.....:..|:|.|           .||   
  Fly     8 LLMLTVLQSHVNS-KFLDDYCGA----PISNQSITKLRQPQAGWLAHI-----------SNGTHV 56

  Fly    71 -CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEI 134
             |.|.|:||:.||:.|.| :..:|   ...|.|||.|               ..:......::.:
  Fly    57 LCSGSLISKQFVLSAAQC-IDVHG---KLFVQLGVSN---------------ATKSPHWYTVSNV 102

  Fly   135 AIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDFRLKT 199
            .| |.:..:.|:..:.:|.|.:.......|.|||          :...|..:..:::.::|....
  Fly   103 VI-PSHSGKRLQRDIGLLKLSQSVDYNDFVYPIC----------IALNTNTLDMVKILQNFTTSA 156

  Fly   200 W-----------VNTLSRGFCQSKVKTLVTSSNTVC 224
            |           ::.|||..|:..:...||... :|
  Fly   157 WLSKNKNPQTIVLSQLSRDRCKLNLSGNVTPKE-IC 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:473915 39/195 (20%)
CG42694NP_001188994.1 Tryp_SPc 46..253 CDD:473915 39/188 (21%)
Tryp_SPc 319..502 CDD:473915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.