DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and CDK1

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001307847.1 Gene:CDK1 / 983 HGNCID:1722 Length:297 Species:Homo sapiens


Alignment Length:296 Identity:169/296 - (57%)
Similarity:215/296 - (72%) Gaps:12/296 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            ::::.:.|||||||||:|||.|..:|||.||:||||||.|.|||||||||||||||.|:|||:|.
Human     1 MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVS 65

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDK--KKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLK 132
            |.||::..:.||:|||:|:|||||.:|.  ........|:|||::|||..:.|||:.|:||||||
Human    66 LQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLK 130

  Fly   133 PQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFS 197
            |||||:|..|.||||||||||||.:|:|.|||||||||||:||:|||:..|||.|||||:|.||:
Human   131 PQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFA 195

  Fly   198 EMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITEHEAH- 261
            |:..::.||.||||||||:||||.|.||:...||.|..|.|:|..||:|:    |..:..|..: 
Human   196 ELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWK----PGSLASHVKNL 256

  Fly   262 -----ELIMSMLCYDPNLRISAKDALQHAYFRNVQH 292
                 :|:..||.|||..|||.|.||.|.||.::.:
Human   257 DENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 169/296 (57%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 167/286 (58%)
CDK1NP_001307847.1 STKc_CDK1_euk 3..287 CDD:270845 167/287 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.