DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk4

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_038935924.1 Gene:Cdk4 / 94201 RGDID:621120 Length:313 Species:Rattus norvegicus


Alignment Length:227 Identity:101/227 - (44%)
Similarity:141/227 - (62%) Gaps:12/227 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VQLFDVVISGN-----NLYMIFEYLNMDLKKLMDKKKDVFTP-QLIKSYMHQILDAVGFCHTNRI 126
            |:|.||..:..     .:.::||:::.||:..:||......| :.||..|.|.|..:.|.|.|.|
  Rat    82 VRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCI 146

  Fly   127 LHRDLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWS 191
            :||||||:|:||.:.|.:|||||||||.::..| |.|..||||||||||:||.:. |:|.||:||
  Rat   147 VHRDLKPENILVTSNGTVKLADFGLARIYSYQM-ALTPVVVTLWYRAPEVLLQST-YATPVDMWS 209

  Fly   192 LGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLP--DFKTKFPRWEGTNMPQP 254
            :||||:||..|:.||.|:||.|||.:||..:..|.|.:||....||  .|..:.||...:.:|: 
  Rat   210 VGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFSPRGPRPVQSVVPE- 273

  Fly   255 ITEHEAHELIMSMLCYDPNLRISAKDALQHAY 286
             .|....:|::.||.::|..||||..||||:|
  Rat   274 -MEESGAQLLLEMLTFNPLKRISAFRALQHSY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 101/227 (44%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 101/227 (44%)
Cdk4XP_038935924.1 PKc_like <82..305 CDD:419665 101/227 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.