DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and CDC28

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_009718.3 Gene:CDC28 / 852457 SGDID:S000000364 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:296 Identity:166/296 - (56%)
Similarity:215/296 - (72%) Gaps:8/296 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTILDNFQRAEKIGEGTYGIVYKARSNSTGQD---VALKKIRLEGETEGVPSTAIREISLLKNL 62
            |:..|.|::|.||:||||||:||||.....||.   |||||||||.|.|||||||||||||||.|
Yeast     1 MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKEL 65

  Fly    63 KHPNVVQLFDVVIS-GNNLYMIFEYLNMDLKKLMD--KKKDVFTPQLIKSYMHQILDAVGFCHTN 124
            |..|:|:|:|:|.| .:.||::||:|::|||:.|:  .|.......::|.:|.|:...:.:||::
Yeast    66 KDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSH 130

  Fly   125 RILHRDLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDI 189
            |||||||||||||::..|.:||.||||||||.||:||||||:|||||||||:|||.|.||||||.
Yeast   131 RILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDT 195

  Fly   190 WSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQ- 253
            ||:||||:||..|:.:|.|||||||:::|||.|.||:|..||.:..|||||..||:|...::.| 
Yeast   196 WSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFPQWRRKDLSQV 260

  Fly   254 -PITEHEAHELIMSMLCYDPNLRISAKDALQHAYFR 288
             |..:....:|:..:|.|||..||||:.|..|.||:
Yeast   261 VPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 165/292 (57%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 161/286 (56%)
CDC28NP_009718.3 STKc_CDK1_CdkB_like 8..295 CDD:270829 161/286 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346225
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H74409
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 1 1.100 - - LDO PTHR24056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.