DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and CDKB2;2

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_173517.1 Gene:CDKB2;2 / 838687 AraportID:AT1G20930 Length:315 Species:Arabidopsis thaliana


Alignment Length:295 Identity:144/295 - (48%)
Similarity:206/295 - (69%) Gaps:13/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNL-KHPNVV 68
            ::.|::.||:||||||.||:||..:||..|||||.||..:.||||.|.:||||:|:.| :.|::|
plant    13 MEAFEKLEKVGEGTYGKVYRAREKATGMIVALKKTRLHEDEEGVPPTTLREISILRMLARDPHIV 77

  Fly    69 QLFDVVISGNN-----LYMIFEYLNMDLKKLMD--KKKDVFTPQ-LIKSYMHQILDAVGFCHTNR 125
            :|.||....|.     ||::|||::.||||.:.  ::.....|| .:|..|:|:...:.|||.:.
plant    78 RLMDVKQGINKEGKTVLYLVFEYVDTDLKKFIRSFRQAGQNIPQNTVKCLMYQLCKGMAFCHGHG 142

  Fly   126 ILHRDLKPQNLLVD-TAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDI 189
            :|||||||.|||:| ....:|:||.||||||.:||:.||||::||||||||:|||...||||||:
plant   143 VLHRDLKPHNLLMDRKTMTLKIADLGLARAFTLPMKKYTHEILTLWYRAPEVLLGATHYSTGVDM 207

  Fly   190 WSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQ- 253
            ||:||||:|::.::::|.||||:.||.||||.|.||:|..||||::|.|:. ::|:|:..::.. 
plant   208 WSVGCIFAELVTKQAIFAGDSELQQLLRIFRLLGTPNEEVWPGVSKLKDWH-EYPQWKPLSLSTA 271

  Fly   254 -PITEHEAHELIMSMLCYDPNLRISAKDALQHAYF 287
             |..:....:|:..||.|:|..|||||.|::|.||
plant   272 VPNLDEAGLDLLSKMLEYEPAKRISAKKAMEHPYF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 144/295 (49%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 142/290 (49%)
CDKB2;2NP_173517.1 PKc_like 14..307 CDD:389743 144/294 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.