DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and CDKB1;1

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_190986.1 Gene:CDKB1;1 / 824585 AraportID:AT3G54180 Length:309 Species:Arabidopsis thaliana


Alignment Length:306 Identity:154/306 - (50%)
Similarity:201/306 - (65%) Gaps:28/306 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHP-NVV 68
            ::.:::.||:||||||.||||....||:.|||||.|||.:.||:|.||:||||||:.|... .||
plant     1 MEKYEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSTSIYVV 65

  Fly    69 QLFDV----------VISGNNLYMIFEYLNMDLKKLMDKKK-----DVFTPQLIKSYMHQILDAV 118
            :|..|          ..:.:|||::||||:.||||.:|..:     ....|.||:..|.|:...|
plant    66 RLLCVEHVHQPSTKSQSTKSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQKLMFQLCKGV 130

  Fly   119 GFCHTNRILHRDLKPQN-LLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKF 182
            ..||::.:||||||||| |||.....:|:||.||.|||.||:::||||:|||||||||:|||:..
plant   131 AHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSTH 195

  Fly   183 YSTGVDIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWE 247
            ||||||:||:||||:||:.|::|||||||..||..|||.|.||.|..||||:.|.|:.. :|:||
plant   196 YSTGVDMWSVGCIFAEMVRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVSTLRDWHV-YPKWE 259

  Fly   248 GTNMPQPIT------EHEAHELIMSMLCYDPNLRISAKDALQHAYF 287
                ||.:|      ..:..:|:..||.|:|..|||||.||.|.||
plant   260 ----PQDLTLAVPSLSPQGVDLLTKMLKYNPAERISAKTALDHPYF 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 154/306 (50%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 152/301 (50%)
CDKB1;1NP_190986.1 PKc_like 2..302 CDD:419665 154/305 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.