DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and CDKB1;2

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001031507.1 Gene:CDKB1;2 / 818444 AraportID:AT2G38620 Length:311 Species:Arabidopsis thaliana


Alignment Length:304 Identity:155/304 - (50%)
Similarity:206/304 - (67%) Gaps:22/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKH----- 64
            ::.:::.||:||||||.||||...:||:.|||||.|||.:.||:|.||:||||||:.|..     
plant     1 MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIV 65

  Fly    65 -----PNVVQLFDVVIS---GNNLYMIFEYLNMDLKKLMDKKKDVFTPQ-----LIKSYMHQILD 116
                 .:|:|..|..:|   .:|||::||||:.||||.:|..:....|:     |::.:|.|:..
plant    66 RLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFK 130

  Fly   117 AVGFCHTNRILHRDLKPQNLLVD-TAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGT 180
            .|..||::.:|||||||||||:| ..|.:|:||.||:|||.||::|||||:|||||||||:|||:
plant   131 GVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGS 195

  Fly   181 KFYSTGVDIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPR 245
            ..|||.|||||:||||:|||.|::|||||||..||..|||.|.||.|..||||..|.|:.. :|:
plant   196 THYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWHV-YPK 259

  Fly   246 WEGTNMPQ--PITEHEAHELIMSMLCYDPNLRISAKDALQHAYF 287
            ||..::.:  |....|..:|:..||.|:|..|||||.||.|.||
plant   260 WEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 155/304 (51%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 153/299 (51%)
CDKB1;2NP_001031507.1 PLN00009 1..306 CDD:177649 155/304 (51%)
STKc_CdkB_plant 2..304 CDD:270830 155/303 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.