DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk16

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_006256679.2 Gene:Cdk16 / 81741 RGDID:620584 Length:578 Species:Rattus norvegicus


Alignment Length:286 Identity:135/286 - (47%)
Similarity:197/286 - (68%) Gaps:4/286 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            |:.:.:.:|:|||||..|||.:|..|...||||:||||.| ||.|.|||||:||||:|||.|:|.
  Rat   244 LETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHE-EGAPCTAIREVSLLKDLKHANIVT 307

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQ 134
            |.|::.:..:|.::||||:.|||:.:|...:|.....:|.::.|:|..:.:||..::||||||||
  Rat   308 LHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNVINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQ 372

  Fly   135 NLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEM 199
            |||::..|::||||||||||.::|.:.|::||||||||.|:||||:..|||.:|:|.:||||.||
  Rat   373 NLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEM 437

  Fly   200 IMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKT-KFPRW--EGTNMPQPITEHEAH 261
            ...|.||||.:..:||:.|||.|.||.|..|||:....:|:| .:|::  |......|..:.:..
  Rat   438 ATGRPLFPGSTVEEQLHFIFRILGTPTEDTWPGILSNEEFRTYNYPKYRAEALLSHAPRLDSDGA 502

  Fly   262 ELIMSMLCYDPNLRISAKDALQHAYF 287
            :|:..:|.::...||||:||::|.:|
  Rat   503 DLLTKLLQFEGRNRISAEDAMKHPFF 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 135/286 (47%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 133/281 (47%)
Cdk16XP_006256679.2 STKc_PCTAIRE1 244..540 CDD:270854 135/286 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.