DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and cdk1

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_997729.1 Gene:cdk1 / 80973 ZFINID:ZDB-GENE-010320-1 Length:302 Species:Danio rerio


Alignment Length:299 Identity:175/299 - (58%)
Similarity:225/299 - (75%) Gaps:7/299 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            :|::.:.|||||||||:|||.|:.:|||.||:||||||.|.|||||||:|||||||.|:|||||:
Zfish     1 MDDYLKIEKIGEGTYGVVYKGRNKTTGQVVAMKKIRLESEEEGVPSTAVREISLLKELQHPNVVR 65

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDK--KKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLK 132
            |.||::..:.||::||:|:|||||.:|.  ..:...|.|:|||::|||:.:.|||..|:||||||
Zfish    66 LLDVLMQESKLYLVFEFLSMDLKKYLDSIPSGEFMDPMLVKSYLYQILEGILFCHCRRVLHRDLK 130

  Fly   133 PQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFS 197
            |||||:|..|.||||||||||||.||:|.||||||||||||||:|||...|||.||:||:|.||:
Zfish   131 PQNLLIDNKGVIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEVLLGASRYSTPVDLWSIGTIFA 195

  Fly   198 EMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITEHEAH- 261
            |:..::.||.||||||||:||||||.||:...||.|..|||:|..||:|:..|:...:...:.: 
Zfish   196 ELATKKPLFHGDSEIDQLFRIFRTLGTPNNEVWPDVESLPDYKNTFPKWKSGNLANTVKNLDKNG 260

  Fly   262 -ELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDHVALP 299
             :|:|.||.|||..||||:.|:.|.||   ..:|..:||
Zfish   261 IDLLMKMLIYDPPKRISARQAMTHPYF---DDLDKSSLP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 172/291 (59%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 169/282 (60%)
cdk1NP_997729.1 PLN00009 1..290 CDD:177649 172/291 (59%)
STKc_CDK1_euk 3..287 CDD:270845 169/283 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.