DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and cdk17

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001188286.1 Gene:cdk17 / 798487 ZFINID:ZDB-GENE-041210-15 Length:526 Species:Danio rerio


Alignment Length:293 Identity:144/293 - (49%)
Similarity:207/293 - (70%) Gaps:12/293 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            |:.:.:.:|:|||||..|:|.||..|...||||:||||.| ||.|.|||||:||||:|||.|:|.
Zfish   192 LETYIKLDKLGEGTYATVFKGRSKLTDNLVALKEIRLEHE-EGAPCTAIREVSLLKDLKHANIVT 255

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQ 134
            |.|:|.:..:|.::||||:.|||:.||...::.:...:|.::.|||..:.:||..::||||||||
Zfish   256 LHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKIFLFQILRGLAYCHRRKVLHRDLKPQ 320

  Fly   135 NLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEM 199
            |||::..|::||||||||||.:||.:.|::||||||||.|::|||:..|||.:|:|.:||||.||
Zfish   321 NLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFYEM 385

  Fly   200 IMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKT-KFPRWEGTNMPQPITEH----- 258
            ...|.||||.:..|:|:.|||.|.||.|.||||::.:.:||: .||:::    |||...|     
Zfish   386 AAGRPLFPGSTVEDELHLIFRLLGTPTEDNWPGISSIEEFKSYNFPKYK----PQPFINHAPRLD 446

  Fly   259 -EAHELIMSMLCYDPNLRISAKDALQHAYFRNV 290
             |..||::|.|.|:...||||.::::|:||:::
Zfish   447 TEGIELLLSFLRYESKKRISADESMKHSYFKSL 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 144/293 (49%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 141/285 (49%)
cdk17NP_001188286.1 STKc_PCTAIRE2 188..496 CDD:143377 144/293 (49%)
PLN00009 192..481 CDD:177649 144/293 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.