DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and cdk15

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_005165792.1 Gene:cdk15 / 791619 ZFINID:ZDB-GENE-060421-7193 Length:461 Species:Danio rerio


Alignment Length:294 Identity:130/294 - (44%)
Similarity:181/294 - (61%) Gaps:14/294 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQLF 71
            ::...||:|||||..|||..|...|..||||.|.::.| ||:|.|||||.||||.|||.|:|.|.
Zfish   126 SYLNLEKLGEGTYATVYKGISRINGHLVALKVIHMKTE-EGIPFTAIREASLLKGLKHANIVLLH 189

  Fly    72 DVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQNL 136
            |::.:..:|..:|||:..||.:.|.:.........|:.:|.|:|..:.:.|..||||||||||||
Zfish   190 DIIHTRESLTFVFEYVQTDLAQYMIQHPGGLHSYNIRLFMFQLLRGLSYIHGRRILHRDLKPQNL 254

  Fly   137 LVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEMIM 201
            |:...|::|||||||||:.::|.:.|:.||||||||.|::|:|:..|||.:|||..||||.||:.
Zfish   255 LISYLGELKLADFGLARSKSIPCQTYSAEVVTLWYRPPDVLMGSTDYSTALDIWGAGCIFIEMLQ 319

  Fly   202 RRSLFPGDSEI-DQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITE-------- 257
            ....|||.::: :||.:|:..:..|.|..||||:.||::|   |.|.....||...:        
Zfish   320 GSPAFPGVADVFEQLLKIWTVIGVPTEEIWPGVSDLPNYK---PEWFLPCKPQQFRDVWKRLSQL 381

  Fly   258 -HEAHELIMSMLCYDPNLRISAKDALQHAYFRNV 290
             ::..:|...||..:|..||||:|||.|.||..:
Zfish   382 PYKTEDLAQQMLMMNPKDRISAQDALLHPYFNTL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 130/294 (44%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 128/288 (44%)
cdk15XP_005165792.1 STKc_PFTAIRE2 126..412 CDD:270852 128/289 (44%)
PLN00009 127..415 CDD:177649 130/291 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.