DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and cdk21

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_005164229.1 Gene:cdk21 / 569515 ZFINID:ZDB-GENE-131121-149 Length:305 Species:Danio rerio


Alignment Length:298 Identity:118/298 - (39%)
Similarity:174/298 - (58%) Gaps:21/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NFQRAEKIGEGTYGIVYKARSNSTGQD-VALKKIRLEGETE-GVPSTAIREISLLKNLK---HPN 66
            :::...:||:|.||.|||||.....|. :|:|::.:..|.| |:|...|||::||:.::   |||
Zfish    10 DYEILAEIGQGAYGKVYKAREKREQQRLIAVKRLNIPEEPESGIPQFMIREVALLRKIEHFNHPN 74

  Fly    67 VVQLFDVVISGNN----LYMIFEYLNMDLKKLMDKKKDV-FTPQLIKSYMHQILDAVGFCHTNRI 126
            :|:|..|.....|    :.::|||::.||...:.:..:. .....||..|.|:|..:.|.|||.:
Zfish    75 IVKLMSVSAGWQNHKFDMTLVFEYIDQDLTTFLSRASEKGLAKDKIKDVMRQLLSGLDFLHTNSV 139

  Fly   127 LHRDLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWS 191
            :||||||.|:||.:.|::|:|||||||.:...: |.|..||||||||||:||.:. |.:.||:||
Zfish   140 IHRDLKPDNVLVSSRGEVKIADFGLARIYTYRI-ALTPCVVTLWYRAPEVLLQSS-YMSSVDMWS 202

  Fly   192 LGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWP---GVTQLPDFKTKFPRWEGTNMPQ 253
            .||||:|:.:.|.||.|.:||.||.:||..:..|.:.:||   .|...|....|.|   .|.:..
Zfish   203 AGCIFAELFLLRPLFRGFTEIQQLQKIFEVIGLPGKEDWPVESPVCYSPALVEKKP---ATQVLA 264

  Fly   254 PITEHEAHELIMSMLCYDPNLRISAKDALQHAYF--RN 289
            .:|..| :.|:...|.::|..||||.:||.|.|.  ||
Zfish   265 SLTPEE-NGLLSQFLAFNPVHRISACEALAHPYLAVRN 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 118/298 (40%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 115/291 (40%)
cdk21XP_005164229.1 STKc_CDK4_6_like 11..297 CDD:270831 115/291 (40%)
S_TKc 11..297 CDD:214567 115/291 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.