DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk1

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_062169.1 Gene:Cdk1 / 54237 RGDID:2319 Length:297 Species:Rattus norvegicus


Alignment Length:296 Identity:169/296 - (57%)
Similarity:216/296 - (72%) Gaps:12/296 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            ::::.:.|||||||||:|||.|..:|||.||:||||||.|.|||||||||||||||.|:|||:|.
  Rat     1 MEDYIKIEKIGEGTYGVVYKGRHRTTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVS 65

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDK--KKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLK 132
            |.||::..:.||:|||:|:|||||.:|.  ........|:|||::|||..:.|||:.|:||||||
  Rat    66 LQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCHSRRVLHRDLK 130

  Fly   133 PQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFS 197
            |||||:|..|.||||||||||||.:|:|.|||||||||||:||:|||:..|||.|||||:|.||:
  Rat   131 PQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFA 195

  Fly   198 EMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITEHEAH- 261
            |:..::.||.||||||||:||||.|.||:...||.|..|.|:|..||:|:    |..:..|..: 
  Rat   196 ELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWK----PGSLASHVKNL 256

  Fly   262 -----ELIMSMLCYDPNLRISAKDALQHAYFRNVQH 292
                 :|:..||.|||..|||.|.||:|.||.::.:
  Rat   257 DENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 169/296 (57%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 167/286 (58%)
Cdk1NP_062169.1 STKc_CDK1_euk 3..287 CDD:270845 167/287 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X960
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.