DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and CDK18

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_016856912.1 Gene:CDK18 / 5129 HGNCID:8751 Length:572 Species:Homo sapiens


Alignment Length:293 Identity:143/293 - (48%)
Similarity:202/293 - (68%) Gaps:12/293 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            |:.:.:.:|:|||||..|:|.||..|...||||:||||.| ||.|.|||||:||||||||.|:|.
Human   239 LETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHE-EGAPCTAIREVSLLKNLKHANIVT 302

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQ 134
            |.|::.:..:|.::||||:.|||:.:|...::.:...:|.:|.|:|..:.:||..:|||||||||
Human   303 LHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQ 367

  Fly   135 NLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEM 199
            |||::..|::||||||||||.:||.:.|::||||||||.|::|||:..|||.:|:|.:|||..||
Human   368 NLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEM 432

  Fly   200 IMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKT-KFPRWEGTNMPQPITEH----- 258
            ...|.||||.:..::|:.|||.|.||.|..|||||...:|:| .||.:    :|||:..|     
Human   433 ATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCY----LPQPLINHAPRLD 493

  Fly   259 -EAHELIMSMLCYDPNLRISAKDALQHAYFRNV 290
             :...|:.|:|.|:...|:||:.||.|:|||::
Human   494 TDGIHLLSSLLLYESKSRMSAEAALSHSYFRSL 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 143/293 (49%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 139/285 (49%)
CDK18XP_016856912.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.