DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and cdk2

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001008136.1 Gene:cdk2 / 493498 XenbaseID:XB-GENE-1001990 Length:297 Species:Xenopus tropicalis


Alignment Length:289 Identity:191/289 - (66%)
Similarity:233/289 - (80%) Gaps:3/289 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            ::|||:.|||||||||:|||||:..||:.||||||||:.|||||||||||||||||.|.|||:|:
 Frog     1 MENFQKVEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVK 65

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKK-DVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKP 133
            |.||:.:.|.||::||:||.||||.||... ...:..|:|||:.|:|..:.|||::|:|||||||
 Frog    66 LLDVIHTENKLYLVFEFLNQDLKKFMDGSNISGISLALVKSYLFQLLQGLAFCHSHRVLHRDLKP 130

  Fly   134 QNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSE 198
            ||||:::.|.||||||||||||.||:|.||||||||||||||||||.|||||.||||||||||:|
 Frog   131 QNLLINSEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKFYSTAVDIWSLGCIFAE 195

  Fly   199 MIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQ--PITEHEAH 261
            ||.||:|||||||||||:||||||.||||.:|||||.:||:|:.||:|...:..:  |..:.:..
 Frog   196 MITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTFPKWVRQDFSKVVPPLDDDGR 260

  Fly   262 ELIMSMLCYDPNLRISAKDALQHAYFRNV 290
            :|:..||.||.|.|||||.||.||:||:|
 Frog   261 DLLAQMLQYDSNKRISAKAALTHAFFRDV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 191/289 (66%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 187/281 (67%)
cdk2NP_001008136.1 STKc_CDK2_3 3..286 CDD:270844 188/282 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 385 1.000 Domainoid score I806
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H74409
Inparanoid 1 1.050 389 1.000 Inparanoid score I1962
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 1 1.000 - - oto102377
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.