DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Pitslre

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster


Alignment Length:313 Identity:135/313 - (43%)
Similarity:194/313 - (61%) Gaps:20/313 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            ::.||...:|.|||||:||:|:...|.:.||||::::|.|.||.|.|::|||:.|...:|||:|.
  Fly   555 VEEFQCLNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREINTLLKGQHPNIVT 619

  Fly    70 LFDVVISGN--NLYMIFEYLNMDLKKLMD---KKKDVFTPQLIKSYMHQILDAVGFCHTNRILHR 129
            :.::|:..|  .::::.:|:..|||.||:   .:|..|.|..:|....|:|.||...|.|.||||
  Fly   620 VREIVVGSNMDKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLRAVAHLHDNWILHR 684

  Fly   130 DLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGC 194
            |||..|||:...|.:|:.||||||.:..|::.||..||||||||||:||.:..|||.:|:||:||
  Fly   685 DLKTSNLLLSHKGILKVGDFGLAREYGSPIKKYTSLVVTLWYRAPELLLCSPVYSTPIDVWSVGC 749

  Fly   195 IFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFK---------TKFPRWEGTN 250
            ||:|.:....||||.||||:|.|||:.|.||:|..|||.|:||..|         |::|..:...
  Fly   750 IFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPGYTELPAVKNMLSQNSQFTEYPVSQLRK 814

  Fly   251 MPQPITEHEAHELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDHVALPVDPN 303
            ..|..|......|:..:|.|||..|:||..||:|.:|:      .:.||:||:
  Fly   815 HFQEKTSEMGLSLLQGLLTYDPKQRLSADAALKHGFFK------ELPLPIDPS 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 131/301 (44%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 130/292 (45%)
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 130/295 (44%)
PLN00009 555..854 CDD:177649 131/304 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.