DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and cdk1

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_988908.1 Gene:cdk1 / 394503 XenbaseID:XB-GENE-482750 Length:302 Species:Xenopus tropicalis


Alignment Length:301 Identity:173/301 - (57%)
Similarity:221/301 - (73%) Gaps:7/301 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            :|.:.:.|||||||||:|||.|..:|||.||:||||||.|.|||||||||||||||.|:|||:|.
 Frog     1 MDEYTKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLENEEEGVPSTAIREISLLKELQHPNIVC 65

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDK--KKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLK 132
            |.||::..:.||:|||:|:|||||.:|.  ........|:|||::|||..:.|||:.|:||||||
 Frog    66 LLDVLMQDSRLYLIFEFLSMDLKKYLDSIPSGQYIDTMLVKSYLYQILQGIVFCHSRRVLHRDLK 130

  Fly   133 PQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFS 197
            |||||:|:.|.||||||||||||.:|:|.||||||||||||||:|||:..|||.||:||:|.||:
 Frog   131 PQNLLIDSKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRAPEVLLGSVRYSTPVDVWSIGTIFA 195

  Fly   198 EMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPI--TEHEA 260
            |:..::.||.||||||||:||||.|.||:...||.|..|.|:|..||:|:|.|:...:  .:.:.
 Frog   196 EIATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKGGNLSANVKNIDKDG 260

  Fly   261 HELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDHVALPVD 301
            .:|:..||.|||..||||:.||.|.||   ..:|..:||.:
 Frog   261 LDLLSKMLIYDPAKRISARKALLHPYF---DDLDKSSLPAN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 170/291 (58%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 167/282 (59%)
cdk1NP_988908.1 STKc_CDK1_euk 3..287 CDD:270845 167/283 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.