DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk4

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:296 Identity:133/296 - (44%)
Similarity:174/296 - (58%) Gaps:21/296 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNL---KHPNVV 68
            |:|....||||.||.||:||...||..|||||:|:.....|||.:.:|||||||.|   .|.|:|
  Fly    25 NYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIV 89

  Fly    69 QLFDVV----ISGNNL-YMIFEYLNMDLKKLMDK-KKDVFTPQLIKSYMHQILDAVGFCHTNRIL 127
            :|::|.    ..|..| .::||::..||..|:|: .|...:|..|:....::|..|.|.|::||:
  Fly    90 KLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRII 154

  Fly   128 HRDLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSL 192
            |||||||||||.:.|.:|:||||||:.:...|: .|..||||||||||:||...:.|| |||||.
  Fly   155 HRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMK-LTSVVVTLWYRAPEVLLAQPYNST-VDIWSA 217

  Fly   193 GCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGV--TQLPDFKTKFPRWEGTNMPQPI 255
            .||..||..||:||||.||.:||.|||.....|.|..||..  ..|..|..:.|:     .|:..
  Fly   218 ACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPK-----RPKDF 277

  Fly   256 TEH---EAHELIMSMLCYDPNLRISAKDALQHAYFR 288
            ..|   .|.:|:..||.||.:||.||...|:|.||:
  Fly   278 CPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 133/296 (45%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 130/292 (45%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 130/292 (45%)
S_TKc 26..312 CDD:214567 130/292 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442452
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.