DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk5

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster


Alignment Length:294 Identity:139/294 - (47%)
Similarity:195/294 - (66%) Gaps:3/294 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            :..:.:.|||||||||.|:|.|:..|.:.||||::||:.:.|||||:|:|||.|||.|||.|:|:
  Fly     1 MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVR 65

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQ 134
            |.||:.|...|.::||:.:.||||..|.........:.:|:|.|:|..:.|||::.:||||||||
  Fly    66 LIDVLHSDKKLTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLKPQ 130

  Fly   135 NLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEM 199
            |||::..|::|||||||||||.:|::.|:.||||||||.|::|.|.|.|:|.:|:||.|||.:|:
  Fly   131 NLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILAEL 195

  Fly   200 I-MRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKT--KFPRWEGTNMPQPITEHEAH 261
            . ..|.||||...:|||.:|||.|.||:|.:||||:.|.|:..  .||.....:...|....:..
  Fly   196 ADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITSWSQLVPRLNSKGR 260

  Fly   262 ELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDH 295
            :|:..:|...||.||||:.|:||.||.:.....|
  Fly   261 DLLQKLLICRPNQRISAEAAMQHPYFTDSSSSGH 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 138/290 (48%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 136/281 (48%)
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 138/286 (48%)
STKc_CDK5 3..286 CDD:143344 136/282 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.