DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and E030030I06Rik

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001241673.1 Gene:E030030I06Rik / 319887 MGIID:2442914 Length:246 Species:Mus musculus


Alignment Length:110 Identity:21/110 - (19%)
Similarity:40/110 - (36%) Gaps:45/110 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EKIGEGTYGIVYKARSNST------------------------------------------GQDV 34
            ||:|..:.|.....:|.||                                          |:.:
Mouse    73 EKVGPSSPGAPEACKSESTHPGSSVPHRQPAASKEKDSLGGADQSTSAWQRSAKAPDLKNGGRFL 137

  Fly    35 ALKKIRLEGETEGVPSTAIREISLLKN---LKHPNVVQLFDVVIS 76
            ..|:.|::...|.:..:.:||:::|::   |:.|.||:.|.:|.|
Mouse   138 IPKRQRVQTSEEDLRLSTVREVAVLRHLETLEQPYVVRAFILVNS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 21/110 (19%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 21/110 (19%)
E030030I06RikNP_001241673.1 PKc_like 114..>177 CDD:304357 11/62 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.