DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk7

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster


Alignment Length:289 Identity:119/289 - (41%)
Similarity:182/289 - (62%) Gaps:6/289 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIR---LEGETEGVPSTAIREISLLKNLKHPNV 67
            :.:.:...:|||.:..|||||...|.|.||:|||:   .|...:|:..||:|||.:|:.|:|.|:
  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENI 74

  Fly    68 VQLFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLK 132
            :.|.||....:|:.::|::::.||:.::...|.:.|...||:|....|..:.:.|.|.|||||||
  Fly    75 IGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHRDLK 139

  Fly   133 PQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFS 197
            |.||||::.|.:|:.|||||::|..|.|.|||.|||.|||:||:|.|.:.|.||||:|::|||.:
  Fly   140 PNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGCILA 204

  Fly   198 EMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITE--HEA 260
            |:::|....||||::|||.|||.||.||.|..||.:::|.|: .:|..:.||.:....|.  ::.
  Fly   205 ELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDY-LQFRNFPGTPLDNIFTAAGNDL 268

  Fly   261 HELIMSMLCYDPNLRISAKDALQHAYFRN 289
            ..|:..:...:|..|:|.::||...||.|
  Fly   269 IHLMQRLFAMNPLRRVSCREALSMPYFAN 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 119/289 (41%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 116/283 (41%)
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 119/289 (41%)
STKc_CDK7 11..308 CDD:270833 119/288 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.