DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk18

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001093976.1 Gene:Cdk18 / 289019 RGDID:1309523 Length:451 Species:Rattus norvegicus


Alignment Length:304 Identity:144/304 - (47%)
Similarity:205/304 - (67%) Gaps:16/304 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            |:.:.:.:|:|||||..|:|.||..|...||||:||||.| ||.|.|||||:||||:|||.|:|.
  Rat   118 LETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHE-EGAPCTAIREVSLLKDLKHANIVT 181

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQ 134
            |.|::.:..:|.::||||:.|||:.:|...::.....:|.:|.|:|..:.:||..:|||||||||
  Rat   182 LHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMNMHNVKIFMFQLLRGLAYCHRRKILHRDLKPQ 246

  Fly   135 NLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEM 199
            |||::..|::||||||||||.:||.:.|::||||||||.|::|||:..|||.:|:|.:|||..||
  Rat   247 NLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEM 311

  Fly   200 IMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKT-KFPRWEGTNMPQPITEH----- 258
            ...:.||||.:..::|:.|||.|.||.|.:|||||.:.:|:. .|||:    :|||:..|     
  Rat   312 ATGKPLFPGSTVKEELHLIFRLLGTPTEESWPGVTSISEFRAYNFPRY----LPQPLLSHAPRLD 372

  Fly   259 -EAHELIMSMLCYDPNLRISAKDALQHAYFRN----VQHVDHVA 297
             |...|:.|:|.|:...|:||:.||.|.||::    |..:|..|
  Rat   373 TEGINLLTSLLLYESKSRMSAEAALSHPYFQSLGERVHQLDDTA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 142/298 (48%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 138/285 (48%)
Cdk18NP_001093976.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..61
PKc_like 115..402 CDD:419665 139/288 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.