DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and srb10

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_593389.2 Gene:srb10 / 2541900 PomBaseID:SPAC23H4.17c Length:369 Species:Schizosaccharomyces pombe


Alignment Length:323 Identity:116/323 - (35%)
Similarity:173/323 - (53%) Gaps:47/323 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DNFQRAEKIGEGTYGIVYKA-RSNSTGQDV-ALKKIRLE-------GETEGVPSTAIREISLLKN 61
            |.::....|..||||.|||| .|||..:.: |:||.:.|       .:..||..:||||:.|.:.
pombe     3 DGYKIIGFISSGTYGKVYKAVSSNSNDKRLFAIKKFKAESKQVSSNAQQTGVSQSAIREMMLCRE 67

  Fly    62 LKHPNVVQLFDVVISGNNLYMIFEYLNMDLKKLMD----KKKDVFTPQLIKSYMHQILDAVGFCH 122
            ::|.|:|.|..|::....:.|:|||...||.:::.    .:.....|.::||.:.||::.|.:.|
pombe    68 IQHENIVSLVQVLLKDGTISMVFEYAEHDLLQIIHFHSRSRTRQIPPSILKSILWQIINGVAYLH 132

  Fly   123 TNRILHRDLKPQNLLVDTAGKIKLADFGLARAFN---VPMRAYTHEVVTLWYRAPEILLGTKFYS 184
            .|.|:||||||.|:::...||:|:.|.||.|...   :|..:....|||:||||||:|||...|:
pombe   133 ENWIMHRDLKPANIMITATGKVKIGDLGLGRLIRDPILPFYSSDRVVVTIWYRAPELLLGAHDYT 197

  Fly   185 TGVDIWSLGCIFSEMIMRRSLFPGDS-----------EIDQLYRIFRTLSTPDETNWPGVT---- 234
            ..:|:|::|||:.||:....||.||.           :..|:.||...|.||.|..|||:.    
pombe   198 PAIDVWAIGCIYGEMLALSPLFKGDEIKMEDKKVVPFQSTQMLRIMELLGTPTEERWPGLKNYPE 262

  Fly   235 --QLPDFKTKF-----PRWEGT---NMPQPITEHEAHELIMSMLCYDPNLRISAKDALQHAYF 287
              ||..|:.::     |:|..|   ..||.:      :|:|.||.|||..||:||.||:|.:|
pombe   263 YYQLSSFEVRYWNNLLPQWYQTVKNRDPQGL------DLLMKMLQYDPKSRITAKQALEHVFF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 116/323 (36%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 114/319 (36%)
srb10NP_593389.2 PTZ00024 1..324 CDD:240233 116/323 (36%)
STKc_CDK8_like 4..319 CDD:270834 114/320 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.