DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and lsk1

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_594393.1 Gene:lsk1 / 2541672 PomBaseID:SPAC2F3.15 Length:593 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:118/296 - (39%)
Similarity:176/296 - (59%) Gaps:27/296 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQLFD 72
            :::.::|||||||.||||.:..||..||||:||||.|.:|.|.|.:||:.:|:.|:|.|:|:|.:
pombe   277 YEKIDQIGEGTYGKVYKAINTVTGDLVALKRIRLEQEKDGFPITTVREVKILQRLRHKNIVRLLE 341

  Fly    73 VVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQNLL 137
            :::..:::||:|||::.||..::...:..|||..||....||.:|:.:.|...:||||:|..|:|
pombe   342 IMVEKSSVYMVFEYMDHDLTGVLLNSQLHFTPGNIKHLSKQIFEALAYLHHRGVLHRDIKGSNIL 406

  Fly   138 VDTAGKIKLADFGLARAFNVPMRA--YTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEMI 200
            ::..|.:|.||||||| ||...::  ||:.|:|||:|.||:|||...|.|.|||||.|||..|:.
pombe   407 LNNNGDLKFADFGLAR-FNTSSKSANYTNRVITLWFRPPELLLGETAYDTAVDIWSAGCIVMELF 470

  Fly   201 MRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITEHE------ 259
            ..:..|.|..||.||..|:..:.|||..:||.|..||.::          :.:|:.|.:      
pombe   471 TGKPFFQGRDEISQLEVIYDMMGTPDVHSWPEVKNLPWYE----------LLKPVEEKKSRFVET 525

  Fly   260 --------AHELIMSMLCYDPNLRISAKDALQHAYF 287
                    |.:|...:|..:|..|.||.:.|.|.||
pombe   526 FKEILSPAAIDLCQKLLALNPFCRPSAHETLMHEYF 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 118/296 (40%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 116/294 (39%)
lsk1NP_594393.1 STKc_CDK9_like 277..561 CDD:270832 116/294 (39%)
S_TKc 277..561 CDD:214567 116/294 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.