DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and ppk23

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_595739.1 Gene:ppk23 / 2540799 PomBaseID:SPBC18H10.15 Length:398 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:132/314 - (42%)
Similarity:181/314 - (57%) Gaps:32/314 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            :|:::..|||.||:|||||:....||...||||||:.:....|.|.|::|||..|.:::|.|:|:
pombe    71 IDDYEILEKIEEGSYGIVYRGLDKSTNTLVALKKIKFDPNGIGFPITSLREIESLSSIRHDNIVE 135

  Fly    70 LFDVVISGN--NLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLK 132
            |..||:..:  ::|::.|::..|||.|:|...:.|....:|:.|.|:|.|..|.|.:..||||||
pombe   136 LEKVVVGKDLKDVYLVMEFMEHDLKTLLDNMPEDFLQSEVKTLMLQLLAATAFMHHHWYLHRDLK 200

  Fly   133 PQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFS 197
            |.|||::..|:||||||||||..:.|..:.|..||||||||||:|||...|...:|:||:||||:
pombe   201 PSNLLMNNTGEIKLADFGLARPVSEPKSSLTRLVVTLWYRAPELLLGAPSYGKEIDMWSIGCIFA 265

  Fly   198 EMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLP--------------DFKTKFPRWEG 248
            |||.|..||.|.||:||||:||..|..|....||....||              ..:|..|...|
pombe   266 EMITRTPLFSGKSELDQLYKIFNLLGYPTREEWPQYFLLPYANKIKHPTVPTHSKIRTSIPNLTG 330

  Fly   249 TNMPQPITEHEAHELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDHVALPVDP 302
                      .|::|:..:|..:|..|||||:||:|.||.....      |.||
pombe   331 ----------NAYDLLNRLLSLNPAKRISAKEALEHPYFYESPR------PKDP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 129/303 (43%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 126/294 (43%)
ppk23NP_595739.1 STKc_CDC2L1 68..359 CDD:173741 127/297 (43%)
PLN00009 71..361 CDD:177649 129/299 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.