DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and pef1

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_587921.1 Gene:pef1 / 2539366 PomBaseID:SPCC16C4.11 Length:288 Species:Schizosaccharomyces pombe


Alignment Length:285 Identity:144/285 - (50%)
Similarity:203/285 - (71%) Gaps:5/285 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQLF 71
            |:||.||:|||||..|||.::..||:.||||.||::.: ||.||||||||||:|.|:|||::.|.
pombe     2 NYQRLEKLGEGTYAHVYKGQNRVTGEIVALKVIRIDAD-EGTPSTAIREISLMKELRHPNIMSLS 65

  Fly    72 DVVISGNNLYMIFEYLNMDLKKLMDK--KKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQ 134
            ||:.:.|.|.::|||:..||||.||.  .:....|..:|::..|:|..:.|||.||:||||||||
pombe    66 DVLQTENKLMLVFEYMEKDLKKYMDTYGNQGALPPSQVKNFTQQLLKGISFCHENRVLHRDLKPQ 130

  Fly   135 NLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEM 199
            |||:::.|::|||||||||:..:|:..:::||||||||||::|||::.|||.:||||:|||.:||
pombe   131 NLLINSRGELKLADFGLARSIGIPVNTFSNEVVTLWYRAPDVLLGSRVYSTSIDIWSVGCIMAEM 195

  Fly   200 IMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQ--PITEHEAHE 262
            ...|.||.|.:..|||.:|||.|.||.|.:|||::.||::|..||.::..::..  |..:....:
pombe   196 ATGRPLFAGSNNEDQLLKIFRLLGTPTEQSWPGISLLPEYKPTFPIYKAQDLAYLFPTFDPLGLD 260

  Fly   263 LIMSMLCYDPNLRISAKDALQHAYF 287
            |:..||...|.||.:.:||||||:|
pombe   261 LLRRMLRLQPELRTTGQDALQHAWF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 144/285 (51%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 142/282 (50%)
pef1NP_587921.1 PKc_like 2..285 CDD:304357 143/283 (51%)
PLN00009 3..285 CDD:177649 142/282 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.