DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk16

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_035179.1 Gene:Cdk16 / 18555 MGIID:97516 Length:496 Species:Mus musculus


Alignment Length:286 Identity:135/286 - (47%)
Similarity:196/286 - (68%) Gaps:4/286 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            |:.:.:.:|:|||||..|||.:|..|...||||:||||.| ||.|.|||||:||||:|||.|:|.
Mouse   162 LETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHE-EGAPCTAIREVSLLKDLKHANIVT 225

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQ 134
            |.|::.:..:|.::||||:.|||:.:|...:|.....:|.::.|:|..:.:||..::||||||||
Mouse   226 LHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNVINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQ 290

  Fly   135 NLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEM 199
            |||::..|::||||||||||.::|.:.|::||||||||.|:||||:..|||.:|:|.:||||.||
Mouse   291 NLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEM 355

  Fly   200 IMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKT-KFPRW--EGTNMPQPITEHEAH 261
            ...|.||||.:..:||:.|||.|.||.|..|||:....:|:| .:|::  |......|..:.:..
Mouse   356 ATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGILSNEEFRTYNYPKYRAEALLSHAPRLDSDGA 420

  Fly   262 ELIMSMLCYDPNLRISAKDALQHAYF 287
            :|:..:|.::...||||:||.:|.:|
Mouse   421 DLLTKLLQFEGRNRISAEDARKHPFF 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 135/286 (47%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 133/281 (47%)
Cdk16NP_035179.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95
STKc_PCTAIRE1 162..458 CDD:270854 135/286 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.